dbPTM

SLX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SLX1_MOUSE
UniProt AC	Q8BX32
Protein Name	Structure-specific endonuclease subunit SLX1 {ECO:0000255\|HAMAP-Rule:MF_03100}
Gene Name	Slx1b
Organism	Mus musculus (Mouse).
Sequence Length	270
Subcellular Localization	Nucleus .
Protein Description	Catalytic subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. Has a preference for 5'-flap structures, and promotes symmetrical cleavage of static and migrating Holliday junctions (HJs). Resolves HJs by generating two pairs of ligatable, nicked duplex products..
Protein Sequence	MDHAARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLAHMLRVPPWVRLPLTLRWLRPDFRHELCPAPPAHMPIAFGPPPPQPLVPKRPAVSEADSERQLDLGTKARCSLCARLLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQLLPLEGHCPSCKKSLLWGNLVGQCHADTEEEEDLELEEEHWTDLLET

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SLX1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SLX1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SLX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SLX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SLX1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SLX1_MOUSE

Related Literatures of Post-Translational Modification