UniProt ID | SLP2_DROME | |
---|---|---|
UniProt AC | P32031 | |
Protein Name | Fork head domain transcription factor slp2 | |
Gene Name | slp2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 451 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor involved in segmentation. May function primarily as a segment polarity gene. Different levels of slp activity seem to be required in different segments.. | |
Protein Sequence | MVKIEEGLPSSEISAHSLHFQHHHHPLPPTTHHSALQSPHPVGLNLTNLMKMARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQPLHKPVTVVSRNS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SLP2_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SLP2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLP2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLP2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SLP2_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...