dbPTM

SLD5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SLD5_SCHPO
UniProt AC	Q9P7C8
Protein Name	DNA replication complex GINS protein sld5
Gene Name	sld5
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	214
Subcellular Localization	Nucleus .
Protein Description	The GINS complex plays an essential role in the initiation of DNA replication. Has a role in chromosome segregation and is required for bir1 localization..
Protein Sequence	MEWDADDLLIEPTTEVENDYEDLCTQWVNERMAPDLLPFAEEIVSRVLDRIEAQRETLQLAIGTSSATSYRSVLMQTELERVKFVLRSYMRTRINKIDKYAQYIQSHPNLLLYLSSPERQYLLRHQQIVHRHYMDSFLREVPAKMNKLDDKVGNLSMVASPDMDTAVFCVVNESVEENFRVSENEYITLDKGDVLILRYSVISDYLRLGVVSLI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SLD5_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SLD5_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SLD5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SLD5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SLD5_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SLD5_SCHPO

Related Literatures of Post-Translational Modification