| UniProt ID | SLAP2_MOUSE | |
|---|---|---|
| UniProt AC | Q8R4L0 | |
| Protein Name | Src-like-adapter 2 | |
| Gene Name | Sla2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 259 | |
| Subcellular Localization | Cytoplasm. Cell membrane. Cytoplasmic vesicle. Late endosome. Localized to the plasma membrane and intracellular vesicles, including late endosomal vesicles. | |
| Protein Description | Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.. | |
| Protein Sequence | MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERHKVTAVALGSFPAGEQARLSLRLGEPLTIISEDGDWWTVQSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRLTFPSLHALVEHYSELADGICCPLREPCVLQKLGPLPGKDTPPPVTVPTSSLNWKKLDRSLLFLEAPASGEASLLSEGLRESLSSYISLAEDPLDDA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGSLSSRGK ------CCCCCCCCC | 36.98 | - | |
| 2 | Myristoylation | ------MGSLSSRGK ------CCCCCCCCC | 36.98 | 11891219 | |
| 12 | Phosphorylation | SSRGKTSSPSPSSSG CCCCCCCCCCCCCCC | 34.33 | 30482847 | |
| 16 | Phosphorylation | KTSSPSPSSSGPDQE CCCCCCCCCCCCCCC | 41.28 | 30482847 | |
| 51 | Phosphorylation | AGEQARLSLRLGEPL HHHHHHHEEECCCCE | 13.09 | 24704852 | |
| 136 | Phosphorylation | YSLSVRLSRPASWDR EEEEEECCCCCCHHH | 26.17 | 23140645 | |
| 201 | Acetylation | KLGPLPGKDTPPPVT CCCCCCCCCCCCCCC | 57.39 | 19861615 | |
| 201 | Ubiquitination | KLGPLPGKDTPPPVT CCCCCCCCCCCCCCC | 57.39 | - | |
| 203 | Phosphorylation | GPLPGKDTPPPVTVP CCCCCCCCCCCCCCC | 40.98 | 25266776 | |
| 208 | Phosphorylation | KDTPPPVTVPTSSLN CCCCCCCCCCCCCCC | 26.92 | 26745281 | |
| 211 | Phosphorylation | PPPVTVPTSSLNWKK CCCCCCCCCCCCCEE | 26.98 | 26745281 | |
| 212 | Phosphorylation | PPVTVPTSSLNWKKL CCCCCCCCCCCCEEC | 27.10 | 26745281 | |
| 213 | Phosphorylation | PVTVPTSSLNWKKLD CCCCCCCCCCCEECC | 28.35 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SLAP2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLAP2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLAP2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ZAP70_MOUSE | Zap70 | physical | 12024036 | |
| CBL_MOUSE | Cbl | physical | 12024036 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Myristoylation | |
| Reference | PubMed |
| "A novel Src homology 2 domain-containing molecule, Src-like adapterprotein-2 (SLAP-2), which negatively regulates T cell receptorsignaling."; Pandey A., Ibarrola N., Kratchmarova I., Fernandez M.M.,Constantinescu S.N., Ohara O., Sawasdikosol S., Lodish H.F., Mann M.; J. Biol. Chem. 277:19131-19138(2002). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION,MYRISTOYLATION AT GLY-2, INTERACTION WITH CBL; ZAP70 AND CD3Z, ANDMUTAGENESIS OF GLY-2; PRO-82 AND ARG-120. | |
| "Functional cooperation between c-Cbl and Src-like adaptor protein 2in the negative regulation of T-cell receptor signaling."; Loreto M.P., Berry D.M., McGlade C.J.; Mol. Cell. Biol. 22:4241-4255(2002). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE INITIATION,CHARACTERIZATION, FUNCTION, MYRISTOYLATION AT GLY-2, PHOSPHORYLATION,INTERACTION WITH ZAP70 AND CBL, AND MUTAGENESIS OF GLY-2; MET-27 ANDARG-120. | |