SIM20_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SIM20_HUMAN
• UniProt AC: Q8N5G0
• Protein Name: Small integral membrane protein 20
• Gene Name: SMIM20
• Organism: Homo sapiens (Human).
• Sequence Length: 67
• Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .
• Protein Description: Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. Promotes the progression of complex assembly after the association of MT-CO1/COX1 with COX4I1 and COX6C. Chaperone-like assembly factor required to stabilize newly synthesized MT-CO1/COX1 and to prevent its premature turnover..
• Protein Sequence: MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	2-Hydroxyisobutyrylation	MRLEEYKKEQAINRA HCHHHHHHHHHHHHC		-
61	Phosphorylation	PPGLKVWSDPFGRK- CCCCEEECCCCCCC-		27251275
64	Amidation	LKVWSDPFGRK---- CEEECCCCCCC----		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SIM20_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SIM20_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SIM20_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SIM20_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.