UniProt ID | SIM14_RAT | |
---|---|---|
UniProt AC | Q498C7 | |
Protein Name | Small integral membrane protein 14 | |
Gene Name | Smim14 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 99 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. |
|
Protein Description | ||
Protein Sequence | MAEGGFDPCECICSHEHAMRRLINLLRQSQSYCTDTECLRELPGPSGDSGISITVILMAWMVIAVLLFLLRPPNLRGSSLPGKPSSPHSGQDPPAPPVD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
78 | Phosphorylation | RPPNLRGSSLPGKPS CCCCCCCCCCCCCCC | 25575281 | ||
79 | Phosphorylation | PPNLRGSSLPGKPSS CCCCCCCCCCCCCCC | 25575281 | ||
83 | Ubiquitination | RGSSLPGKPSSPHSG CCCCCCCCCCCCCCC | - | ||
85 | Phosphorylation | SSLPGKPSSPHSGQD CCCCCCCCCCCCCCC | 25575281 | ||
86 | Phosphorylation | SLPGKPSSPHSGQDP CCCCCCCCCCCCCCC | 25575281 | ||
89 | Phosphorylation | GKPSSPHSGQDPPAP CCCCCCCCCCCCCCC | 25575281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIM14_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIM14_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIM14_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SIM14_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...