UniProt ID | SIM13_HUMAN | |
---|---|---|
UniProt AC | P0DJ93 | |
Protein Name | Small integral membrane protein 13 | |
Gene Name | SMIM13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 91 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | LRELVGDTGSQEGDH HHHHHCCCCCCCCCC | 22167270 | ||
50 | Phosphorylation | ELVGDTGSQEGDHEP HHHCCCCCCCCCCCC | 22167270 | ||
58 | Phosphorylation | QEGDHEPSGSETEED CCCCCCCCCCCCCCC | 22167270 | ||
60 | Phosphorylation | GDHEPSGSETEEDTS CCCCCCCCCCCCCCC | 26503892 | ||
62 | Phosphorylation | HEPSGSETEEDTSSS CCCCCCCCCCCCCCC | 22167270 | ||
66 | Phosphorylation | GSETEEDTSSSPHRI CCCCCCCCCCCHHHH | 22167270 | ||
67 | Phosphorylation | SETEEDTSSSPHRIR CCCCCCCCCCHHHHH | 22167270 | ||
68 | Phosphorylation | ETEEDTSSSPHRIRS CCCCCCCCCHHHHHH | 22167270 | ||
69 | Phosphorylation | TEEDTSSSPHRIRSA CCCCCCCCHHHHHHH | 22167270 | ||
91 | Phosphorylation | DEGHRPLT------- CCCCCCCC------- | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIM13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIM13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIM13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SIM13_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...