| UniProt ID | SIM13_HUMAN | |
|---|---|---|
| UniProt AC | P0DJ93 | |
| Protein Name | Small integral membrane protein 13 | |
| Gene Name | SMIM13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 91 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Phosphorylation | LRELVGDTGSQEGDH HHHHHCCCCCCCCCC | 22167270 | ||
| 50 | Phosphorylation | ELVGDTGSQEGDHEP HHHCCCCCCCCCCCC | 22167270 | ||
| 58 | Phosphorylation | QEGDHEPSGSETEED CCCCCCCCCCCCCCC | 22167270 | ||
| 60 | Phosphorylation | GDHEPSGSETEEDTS CCCCCCCCCCCCCCC | 26503892 | ||
| 62 | Phosphorylation | HEPSGSETEEDTSSS CCCCCCCCCCCCCCC | 22167270 | ||
| 66 | Phosphorylation | GSETEEDTSSSPHRI CCCCCCCCCCCHHHH | 22167270 | ||
| 67 | Phosphorylation | SETEEDTSSSPHRIR CCCCCCCCCCHHHHH | 22167270 | ||
| 68 | Phosphorylation | ETEEDTSSSPHRIRS CCCCCCCCCHHHHHH | 22167270 | ||
| 69 | Phosphorylation | TEEDTSSSPHRIRSA CCCCCCCCHHHHHHH | 22167270 | ||
| 91 | Phosphorylation | DEGHRPLT------- CCCCCCCC------- | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIM13_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIM13_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIM13_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SIM13_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...