dbPTM

SIB1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SIB1_ARATH
UniProt AC	Q9LDH1
Protein Name	Sigma factor binding protein 1, chloroplastic
Gene Name	SIB1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	151
Subcellular Localization	Plastid, chloroplast . Nucleus . Can localize to both chloroplast and nucleus.
Protein Description	Contributes to plant defense. May regulate chloroplast metabolism upon infection with pathogens such as Pseudomonas syringae. [PubMed: 20040062 Functions as activator of WRKY33 in plant defense against necrotrophic pathogens by stimulating the DNA-binding activity of WRKY33]
Protein Sequence	MESSSSTFLTTTSLDKKKPSPVSRKSPKQKKKTTSTNKPIKVRYISNPMRVQTCASKFRELVQELTGQDAVDLQPEPIYSPSSDDHNLSPPAENLAPRVLHQEPFGERDSDCYEPLNAEDMFLPDQMSAGFSGFFSNGFYNVNDFGSIDSM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SIB1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SIB1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SIB1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SIB1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
WRK20_ARATH	WRKY20	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SIB1_ARATH

Related Literatures of Post-Translational Modification