dbPTM

SIAH1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SIAH1_CAEEL
UniProt AC	Q965X6
Protein Name	E3 ubiquitin-protein ligase siah-1
Gene Name	siah-1
Organism	Caenorhabditis elegans.
Sequence Length	419
Subcellular Localization
Protein Description	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates..
Protein Sequence	MSNRNGGGGGGDYQDVIESLRRTQLIFEEDDNNSSDSAPQANHLSRHQTSNSLVEDMVNHSNGNPPPVPPGITQQQCQIGLTPRMSASPPSAVSTISGTAVLGKTMARVQSNPPGSIPHNTTTTAQGIQSVAPHIPIGGGGATDDSSAEILSVFECPVCLEYMLPPYMQCSSGHLVCSNCRPKLQCCPTCRGPTPSVRNLGLEKIANTVRFPCKFSTSGCPLNFHHADKTEHEELCEFRPYCCPCPGASCKWQGGLSDVMEHLKKIHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFDYNFMLVLEKQEKYDPAQPTQMFYAVVQLIGSKKEADNFVYRLELSASRRRMSWEATPRSIHEGVVVAIQQSDCLAFDSNAAQLFAENGNLGINVTISRIDTPQRRHPNELENSDLEYD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SIAH1_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SIAH1_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SIAH1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SIAH1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SIAH1_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SIAH1_CAEEL

Related Literatures of Post-Translational Modification