| UniProt ID | SIA8B_MOUSE | |
|---|---|---|
| UniProt AC | O35696 | |
| Protein Name | Alpha-2,8-sialyltransferase 8B | |
| Gene Name | St8sia2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 375 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
| Protein Description | May transfer sialic acid through alpha-2,8-linkages to the alpha-2,3-linked and alpha-2,6-linked sialic acid of N-linked oligosaccharides of glycoproteins and may be involved in PSA (polysialic acid) expression.. | |
| Protein Sequence | MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | GNSGGRGTIRSAVNS HCCCCHHHHHHHHHH | 16.32 | - | |
| 43 | Phosphorylation | GGRGTIRSAVNSLHS CCHHHHHHHHHHHHC | 32.49 | - | |
| 60 | N-linked_Glycosylation | NRAEVVINGSSPPAV CCEEEEECCCCCCCC | 32.46 | - | |
| 72 | N-linked_Glycosylation | PAVADRSNESLKHNI CCCCCCCCHHHHHCC | 43.71 | - | |
| 89 | N-linked_Glycosylation | ASSKWRHNQTLSLRI CCCCCCCCCCHHHHH | 28.14 | - | |
| 134 | N-linked_Glycosylation | FDRDSTMNVSQNLYE ECCCCCCCCCHHHHH | 30.31 | - | |
| 219 | N-linked_Glycosylation | RAFEDLVNATWREKL HHHHHHHCHHHHHHH | 38.66 | - | |
| 234 | N-linked_Glycosylation | LQRLHGLNGSILWIP HHHHCCCCCEEEEHH | 46.92 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA8B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA8B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA8B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SIA8B_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
