| UniProt ID | SIA7F_HUMAN | |
|---|---|---|
| UniProt AC | Q969X2 | |
| Protein Name | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 | |
| Gene Name | ST6GALNAC6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 333 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein. |
|
| Protein Description | Alpha-2,6-sialyltransferase involved in the synthesis of alpha-series gangliosides. Has activity toward GD1a, GT1b and GM1b. Has no activity toward glycoproteins. Responsible for the biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. Participates in the synthesis of disialyl Lewis a (Le(a)).. | |
| Protein Sequence | MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MACSRPPSQCEPTSL CCCCCCHHHCCCCCC | 50.58 | 23090842 | |
| 13 | Phosphorylation | PPSQCEPTSLPPGPP CHHHCCCCCCCCCCC | 22.17 | 23090842 | |
| 14 | Phosphorylation | PSQCEPTSLPPGPPA HHHCCCCCCCCCCCC | 49.98 | 23090842 | |
| 43 | Phosphorylation | SSNKEQRSAVFVILF HCCHHHHHHHHHHHH | 28.60 | 22210691 | |
| 59 | Phosphorylation | LITILILYSSNSANE HHHHHHHHCCCCCCC | 11.76 | 22210691 | |
| 61 | Phosphorylation | TILILYSSNSANEVF HHHHHHCCCCCCCCE | 22.65 | 22210691 | |
| 63 | Phosphorylation | LILYSSNSANEVFHY HHHHCCCCCCCCEEC | 34.12 | 22210691 | |
| 70 | Phosphorylation | SANEVFHYGSLRGRS CCCCCEECCCCCCCC | 9.28 | 22210691 | |
| 72 | Phosphorylation | NEVFHYGSLRGRSRR CCCEECCCCCCCCCC | 14.02 | 22210691 | |
| 98 | N-linked_Glycosylation | GYVPILGNKTLPSRC CCCCCCCCCCCCCCC | 30.60 | UniProtKB CARBOHYD | |
| 195 | Phosphorylation | KMQKPQGSLVRVIQR HHCCCCCCHHHHHHH | 20.60 | 24043423 | |
| 213 | Phosphorylation | VFPNMEAYAVSPGRM CCCCCEEEEECCCCC | 8.33 | 24043423 | |
| 216 | Phosphorylation | NMEAYAVSPGRMRQF CCEEEEECCCCCCCH | 17.29 | 24043423 | |
| 301 | Phosphorylation | TYIQNEHSRKGNHHR HHHCCCCCCCCCCCC | 29.52 | 25850435 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA7F_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA7F_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA7F_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SIA7F_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
