| UniProt ID | SIA7D_HUMAN | |
|---|---|---|
| UniProt AC | Q9H4F1 | |
| Protein Name | Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase | |
| Gene Name | ST6GALNAC4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 302 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein. |
|
| Protein Description | Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. Prefers glycoproteins to glycolipids (By similarity).. | |
| Protein Sequence | MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 125 | Phosphorylation | RSTLRVVSHTSVPLL CCEEEEEEECCHHHH | 20.42 | 30257219 | |
| 135 | N-linked_Glycosylation | SVPLLLRNYSHYFQK CHHHHHHCCHHHHHH | 42.50 | UniProtKB CARBOHYD | |
| 173 | Phosphorylation | YRTLLQLTRMYPGLQ HHHHHHHHHHCCCCE | 10.63 | - | |
| 176 | Phosphorylation | LLQLTRMYPGLQVYT HHHHHHHCCCCEEEE | 7.28 | 24043423 | |
| 182 | Phosphorylation | MYPGLQVYTFTERMM HCCCCEEEEEHHHHH | 5.33 | 24043423 | |
| 183 | Phosphorylation | YPGLQVYTFTERMMA CCCCEEEEEHHHHHH | 25.81 | 24043423 | |
| 185 | Phosphorylation | GLQVYTFTERMMAYC CCEEEEEHHHHHHHH | 18.19 | 24043423 | |
| 217 | Phosphorylation | FLSTGWFTMILALEL CCCHHHHHHHHHHHH | 9.22 | - | |
| 280 | Ubiquitination | AHRFITEKAVFSRWA HHHHHHHHHHHHHHH | 41.00 | - | |
| 298 | Phosphorylation | PIVFAHPSWRTE--- CEEEECCCCCCC--- | 21.23 | 23927012 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA7D_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA7D_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA7D_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SIA7D_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298, AND MASSSPECTROMETRY. | |
