UniProt ID | SIA7B_HUMAN | |
---|---|---|
UniProt AC | Q9UJ37 | |
Protein Name | Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 | |
Gene Name | ST6GALNAC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 374 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
Protein Description | Catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins.. | |
Protein Sequence | MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | YFSAVQRYPGPAAGA HHHHHHHCCCCCCCC | 8.75 | - | |
85 | N-linked_Glycosylation | PHFRGLFNLSIPVLL CCHHHHHCCCCCCHH | 37.61 | 29251719 | |
127 | Phosphorylation | QVIASTLSLLNGSES HHHHHHHHHHCCCCC | 30.79 | - | |
130 | N-linked_Glycosylation | ASTLSLLNGSESAKL HHHHHHHCCCCCCCC | 58.18 | 29251719 | |
132 | Phosphorylation | TLSLLNGSESAKLFA HHHHHCCCCCCCCCC | 27.57 | - | |
161 | N-linked_Glycosylation | VGNGGILNGSRQGPN ECCCCCCCCCCCCCC | 44.46 | 29251719 | |
194 | Phosphorylation | ERDVGTKTSFYGFTV ECCCCCCCEEEEEEE | 24.73 | 28985074 | |
195 | Phosphorylation | RDVGTKTSFYGFTVN CCCCCCCEEEEEEEC | 20.30 | 28985074 | |
197 | Phosphorylation | VGTKTSFYGFTVNTM CCCCCEEEEEEECCC | 15.88 | 28985074 | |
217 | O-linked_Glycosylation | SYWNLGFTSVPQGQD HHHCCCCCCCCCCCC | 27.32 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA7B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA7B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA7B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SIA7B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...