| UniProt ID | SHSA5_HUMAN | |
|---|---|---|
| UniProt AC | Q8N114 | |
| Protein Name | Protein shisa-5 | |
| Gene Name | SHISA5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 240 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . Nucleus membrane . |
|
| Protein Description | Can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.. | |
| Protein Sequence | MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Methylation | TAPVPAPRILLPLLL CCCCCHHHHHHHHHH | 34.00 | 115387651 | |
| 82 | O-linked_Glycosylation | PEASVPASVEPVEQL CCCCCCCCCCCHHHH | 22.42 | OGP | |
| 129 | Phosphorylation | VTIIICFTCSCCCLY HHHHHHHHHHHHHHH | 10.09 | - | |
| 131 | Phosphorylation | IIICFTCSCCCLYKT HHHHHHHHHHHHHHH | 13.71 | - | |
| 136 | Phosphorylation | TCSCCCLYKTCRRPR HHHHHHHHHHCCCCC | 7.13 | - | |
| 149 | O-linked_Glycosylation | PRPVVTTTTSTTVVH CCCEEEEECCCEEEE | 14.91 | OGP | |
| 152 | O-linked_Glycosylation | VVTTTTSTTVVHAPY EEEEECCCEEEECCC | 22.86 | OGP | |
| 153 | O-linked_Glycosylation | VTTTTSTTVVHAPYP EEEECCCEEEECCCC | 21.94 | OGP | |
| 168 | O-linked_Glycosylation | QPPSVPPSYPGPSYQ CCCCCCCCCCCCCCC | 37.58 | OGP | |
| 221 | Phosphorylation | AGGAAAPYPASQPPY CCCCCCCCCCCCCCC | 13.50 | 22817900 | |
| 224 | O-linked_Glycosylation | AAAPYPASQPPYNPA CCCCCCCCCCCCCHH | 38.42 | OGP | |
| 228 | Phosphorylation | YPASQPPYNPAYMDA CCCCCCCCCHHHCCC | 40.22 | 22817900 | |
| 232 | Phosphorylation | QPPYNPAYMDAPKAA CCCCCHHHCCCCHHC | 9.22 | 22817900 | |
| 237 | Ubiquitination | PAYMDAPKAAL---- HHHCCCCHHCC---- | 48.27 | - | |
| 237 | Sumoylation | PAYMDAPKAAL---- HHHCCCCHHCC---- | 48.27 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHSA5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHSA5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHSA5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SHSA5_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
