SHAKB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SHAKB_DROME
• UniProt AC: P33085
• Protein Name: Innexin shaking-B
• Gene Name: shakB
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 372
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Cell junction, gap junction.
• Protein Description: Structural component of the gap junctions at electrical synapses in distal and mid-depth levels in the lamina. Isoform Lethal forms voltage sensitive intercellular channels through homotypic interactions..
• Protein Sequence: MLDIFRGLKNLVKVSHVKTDSIVFRLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDIPEDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIEIIVRRSKMGDWFLLYLLGENIDTVIFRDVVQDLANRLGHNQHHRVPGLKGEIQDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SHAKB_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SHAKB_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SHAKB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SHAKB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
INX7_DROME	Inx7	genetic	12154069

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.