| UniProt ID | SH3G1_RAT | |
|---|---|---|
| UniProt AC | O35964 | |
| Protein Name | Endophilin-A2 | |
| Gene Name | Sh3gl1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 368 | |
| Subcellular Localization |
Cytoplasm . Early endosome membrane Peripheral membrane protein . Cell projection, podosome. Associated with postsynaptic endosomes in hippocampal neurons. |
|
| Protein Description | Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).. | |
| Protein Sequence | MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFREMEKKVDITSKAVAEVLVRTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMVRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASSRPRREFKPRPQEPFELGELEQPNGGFPCASAPKITASSSFRSGDKPTRTPSKSMPPLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Acetylation | -MSVAGLKKQFYKAS -CCHHHHHHHHHHHH | 43.54 | 59118145 | |
| 171 | Acetylation | RRLDFDYKKKRQGKI CCCCCCHHHHHCCCC | 54.38 | - | |
| 177 | Acetylation | YKKKRQGKIPDEELR HHHHHCCCCCHHHHH | 42.60 | 1149326285 | |
| 241 | Acetylation | EELADKLKRRVREAS HHHHHHHHHHHHHHH | 43.85 | 22902405 | |
| 284 | Phosphorylation | CASAPKITASSSFRS CCCCCEEEECCCCCC | 26.98 | 26437020 | |
| 286 | Phosphorylation | SAPKITASSSFRSGD CCCEEEECCCCCCCC | 20.19 | 27097102 | |
| 287 | Phosphorylation | APKITASSSFRSGDK CCEEEECCCCCCCCC | 30.91 | 27097102 | |
| 288 | Phosphorylation | PKITASSSFRSGDKP CEEEECCCCCCCCCC | 23.37 | 27097102 | |
| 298 | Phosphorylation | SGDKPTRTPSKSMPP CCCCCCCCCCCCCCC | 34.10 | 25575281 | |
| 300 | Phosphorylation | DKPTRTPSKSMPPLD CCCCCCCCCCCCCCC | 36.43 | 22276854 | |
| 302 | Phosphorylation | PTRTPSKSMPPLDQP CCCCCCCCCCCCCCC | 40.64 | 25575281 | |
| 315 | Phosphorylation | QPSCKALYDFEPEND CCCCCCCCCCCCCCC | 24.36 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SH3G1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SH3G1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SH3G1_RAT !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...