| UniProt ID | SGTB_RAT | |
|---|---|---|
| UniProt AC | Q80W98 | |
| Protein Name | Small glutamine-rich tetratricopeptide repeat-containing protein beta | |
| Gene Name | Sgtb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 304 | |
| Subcellular Localization | ||
| Protein Description | Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.. | |
| Protein Sequence | MSSVKPLVYAVIRFLREQSQMDAYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTNSVCKNDIRPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLTFDMASLINNPAFITMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSTEEHS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Phosphorylation | KNDIRPLSNSVPEDV CCCCCCCCCCCCCCC | 29.73 | 27097102 | |
| 77 | Phosphorylation | DIRPLSNSVPEDVGK CCCCCCCCCCCCCCC | 35.36 | 27097102 | |
| 131 | Acetylation | NRAAAQSKLSHYTDA CHHHHHHHHHHHHHH | 41.76 | - | |
| 194 | Ubiquitination | DSYKSNLKIAEQKLR CCHHHHHHHHHHHHH | 44.09 | - | |
| 293 | Phosphorylation | QLRNHIRSRSFSSST HHHHHHHHCCCCCCC | 31.50 | 28432305 | |
| 295 | Phosphorylation | RNHIRSRSFSSSTEE HHHHHHCCCCCCCCC | 30.63 | 23984901 | |
| 297 | Phosphorylation | HIRSRSFSSSTEEHS HHHHCCCCCCCCCCC | 25.32 | 28432305 | |
| 298 | Phosphorylation | IRSRSFSSSTEEHS- HHHCCCCCCCCCCC- | 38.99 | 28432305 | |
| 299 | Phosphorylation | RSRSFSSSTEEHS-- HHCCCCCCCCCCC-- | 38.34 | 28432305 | |
| 300 | Phosphorylation | SRSFSSSTEEHS--- HCCCCCCCCCCC--- | 47.54 | 28432305 | |
| 304 | Phosphorylation | SSSTEEHS------- CCCCCCCC------- | 45.24 | 22673903 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGTB_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGTB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGTB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SGTB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
