SGMR1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SGMR1_HUMAN
• UniProt AC: Q99720
• Protein Name: Sigma non-opioid intracellular receptor 1
• Gene Name: SIGMAR1
• Organism: Homo sapiens (Human).
• Sequence Length: 223
• Subcellular Localization: Nucleus inner membrane . Nucleus outer membrane . Nucleus envelope . Cytoplasmic vesicle . Endoplasmic reticulum membrane . Membrane ; Single-pass membrane protein . Lipid droplet . Cell junction. Cell membrane . Cell projection, growth cone. Cell junctio
• Protein Description: Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration. [PubMed: 16472803]
• Protein Sequence: MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
106 (in isoform 5)	Ubiquitination	-	2.38	21906983
122 (in isoform 2)	Ubiquitination	-	8.70	21906983
127	Phosphorylation	YWAEISDTIISGTFH CCEEEECEEEEECCC	17.27	-
141	Phosphorylation	HQWREGTTKSEVFYP CCCCCCCCCCEEEEC	43.35	-
142	Ubiquitination	QWREGTTKSEVFYPG CCCCCCCCCEEEECC	44.44	2190698
142 (in isoform 1)	Ubiquitination	-	44.44	21906983
202	Phosphorylation	DFLTLFYTLRSYARG HHHHHHHHHHHHHHH	14.36	24719451
205	Phosphorylation	TLFYTLRSYARGLRL HHHHHHHHHHHHCHH	26.68	22210691
206	Phosphorylation	LFYTLRSYARGLRLE HHHHHHHHHHHCHHE	8.22	22210691
217	Phosphorylation	LRLELTTYLFGQDP- CHHEHHHHHCCCCC-	8.52	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SGMR1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SGMR1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SGMR1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ITPR3_HUMAN	ITPR3	physical	11149946
ANK2_HUMAN	ANK2	physical	11149946
STOM_HUMAN	STOM	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 614373: Amyotrophic lateral sclerosis 16, juvenile (ALS16)
• Kegg Drug
• D01477: Opipramol hydrochloride (JAN/USAN); Insidon (TN)
• D02682: Remoxipride (USAN)
• D02683: Remoxipride hydrochloride (USAN)
• D02684: Rimcazole hydrochloride (USAN)
• D02688: Tiospirone hydrochloride (USAN)
• D04502: Igmesine hydrochloride (USAN)
• D08297: Opipramol (INN); Opipramol dura (TN)
• DrugBank
• DB00321: Amitriptyline
• DB09014: Captodiame
• DB00514: Dextromethorphan
• DB00540: Nortriptyline
• DB00652: Pentazocine
• DB00409: Remoxipride