SFXN3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SFXN3_MOUSE
• UniProt AC: Q91V61
• Protein Name: Sideroflexin-3
• Gene Name: Sfxn3
• Organism: Mus musculus (Mouse).
• Sequence Length: 321
• Subcellular Localization: Mitochondrion membrane; Multi-pass membrane protein.
• Protein Description: Potential iron transporter..
• Protein Sequence: MGDLPLNINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGEQLEASRNIVQNYRAGVATPGLTEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDAPITVQQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVTDEAGQRLGHSVTAAKQGIFQVVISRIGMAIPAMAIPPVIMNTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQRSSIHVTRLEPELRAQIQAQNPSIDVVYYNKGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MGDLPLNI -------CCCCCCEE	9.46	-
59	Phosphorylation	NYRAGVATPGLTEDQ HHCCCCCCCCCCHHH	18.58	29514104
169	Acetylation	LGLKSLTKHLPPLVG HCHHHHHHCCCCCCC	48.73	51083855
311	Phosphorylation	QIQAQNPSIDVVYYN HHHHCCCCCCEEEEE	38.68	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SFXN3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SFXN3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SFXN3_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SFXN3_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.