dbPTM

SFT2C_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SFT2C_HUMAN
UniProt AC	Q587I9
Protein Name	Vesicle transport protein SFT2C
Gene Name	SFT2D3 {ECO:0000312\|HGNC:HGNC:28767}
Organism	Homo sapiens (Human).
Sequence Length	215
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description	May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex..
Protein Sequence	MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAESAAAGLTCLPSVTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALALAGSALLRGGAACGRLLRCEEAPSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAALLAALVGLLPWGGGTALRLALGRLGRGAGLAKVLPV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	LHRQLQEYLAQGKAG HHHHHHHHHHCCCCC	8.38	25884760
16	Ubiquitination	QEYLAQGKAGGPAAA HHHHHCCCCCCCCHH	31.60	21906983
31	Ubiquitination	EPLLAAEKAEEPGDR HHHHHHHHCCCCCCC	57.27	33845483
56	Phosphorylation	LRWTWARSPAESAAA CCCEECCCHHHHHHC	22.25	25850435
97	Phosphorylation	CFGLAALYAPVLLLR HHHHHHHHHHHHHHH	12.25	-
211	Ubiquitination	GRGAGLAKVLPV--- CCCCCCCHHCCC---	49.71	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SFT2C_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SFT2C_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SFT2C_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SFT2C_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SFT2C_HUMAN

Related Literatures of Post-Translational Modification