| UniProt ID | SF3B4_MOUSE | |
|---|---|---|
| UniProt AC | Q8QZY9 | |
| Protein Name | Splicing factor 3B subunit 4 | |
| Gene Name | Sf3b4 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 424 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.. | |
| Protein Sequence | MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAGGHGPPAAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAAGPISER ------CCCCCCCCC | 22.56 | - | |
| 16 | Phosphorylation | RNQDATVYVGGLDEK CCCCCEEEECCCCHH | 6.77 | 22817900 | |
| 56 | Phosphorylation | VTGQHQGYGFVEFLS CCCCCCCCEEEEECC | 10.79 | - | |
| 80 | Phosphorylation | IMNMIKLYGKPIRVN HHHHHHHHCCCEEEC | 20.36 | 29895711 | |
| 117 | Phosphorylation | EIDEKLLYDTFSAFG HHCHHHHHHHHHHHH | 24.31 | 22817900 | |
| 129 | Phosphorylation | AFGVILQTPKIMRDP HHHHHHCCCCCCCCC | 24.09 | 26745281 | |
| 409 | Dimethylation | PPPRPTPRPPVPPRG CCCCCCCCCCCCCCC | 51.11 | - | |
| 409 | Methylation | PPPRPTPRPPVPPRG CCCCCCCCCCCCCCC | 51.11 | 30763141 | |
| 415 | Dimethylation | PRPPVPPRGPLRGPL CCCCCCCCCCCCCCC | 53.98 | - | |
| 415 | Methylation | PRPPVPPRGPLRGPL CCCCCCCCCCCCCCC | 53.98 | 30763147 | |
| 419 | Dimethylation | VPPRGPLRGPLPQ-- CCCCCCCCCCCCC-- | 48.06 | - | |
| 419 | Methylation | VPPRGPLRGPLPQ-- CCCCCCCCCCCCC-- | 48.06 | 24395703 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SF3B4_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SF3B4_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SF3B4_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SF3B4_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
