dbPTM

SERCL_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SERCL_ARATH
UniProt AC	F4KI56
Protein Name	Metal-independent phosphoserine phosphatase
Gene Name	IPSP
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	238
Subcellular Localization
Protein Description	Phosphoglycerate mutase-like protein lacking PGM activity, but having a low metal-independent phosphoserine phosphatase activity in vitro. May be involved in serine biosynthesis..
Protein Sequence	MGHEWIDAEREFKWSEDVKVESEVTEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLGKEERPVAVYSSDLKRAKDTALMIAKTCFCPEVIEVPDLKERHVGSLQGLYWKEGAEKEPEAYSAFFSSQNDLEIPGGGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRAIYLRITQASSAGKLLNASVNVVHLRDQKWIIDSWSDVSHLSSVGFLQRGFDGDAKP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SERCL_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SERCL_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SERCL_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SERCL_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SERCL_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SERCL_ARATH

Related Literatures of Post-Translational Modification