UniProt ID | SERB_MOUSE | |
---|---|---|
UniProt AC | Q99LS3 | |
Protein Name | Phosphoserine phosphatase | |
Gene Name | Psph | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 225 | |
Subcellular Localization | ||
Protein Description | Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates (By similarity).. | |
Protein Sequence | MVSHSELRKLFCSADAVCFDVDSTVIREEGIDELAKFCGVEAAVSEMTRRAMGGALPFKDALTQRLALIQPSRDQVQRLLAEHPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVAAKLNIPTTNVFANRLKFYFNGEYAGFDEMQPTAESGGKGKVIRFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MVSHSELR -------CCCHHHHH | 6.69 | - | |
3 | Phosphorylation | -----MVSHSELRKL -----CCCHHHHHHH | 21.72 | 28833060 | |
5 | Phosphorylation | ---MVSHSELRKLFC ---CCCHHHHHHHHH | 30.71 | 28066266 | |
38 | Glutathionylation | IDELAKFCGVEAAVS HHHHHHHHCHHHHHH | 6.18 | 24333276 | |
59 | Acetylation | MGGALPFKDALTQRL HCCCCCHHHHHHHHH | 39.90 | 22826441 | |
122 | Acetylation | IVEHVAAKLNIPTTN HHHHHHHHCCCCCCH | 32.12 | 22826441 | |
210 | Ubiquitination | QQVKDNAKWYITDFV HHHHHHCCEEHHHHH | 46.94 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SERB_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SERB_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SERB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SERB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...