SEP15_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SEP15_MOUSE
• UniProt AC: Q9ERR7
• Protein Name: Selenoprotein F {ECO:0000250|UniProtKB:O60613}
• Gene Name: Selenof {ECO:0000312|MGI:MGI:1927947}
• Organism: Mus musculus (Mouse).
• Sequence Length: 162
• Subcellular Localization: Endoplasmic reticulum lumen. The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum..
• Protein Description: May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum (By similarity)..
• Protein Sequence: MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFASEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
119	Acetylation	LFRGLQIKYVRGSDP CCCCEEEEEEECCCC	25.40	22826441
148	Phosphorylation	LSILKWNTDSVEEFL HHHHCCCCHHHHHHH	28.65	24719451
150	Phosphorylation	ILKWNTDSVEEFLSE HHCCCCHHHHHHHHH	29.41	23737553
156	Phosphorylation	DSVEEFLSEKLERI- HHHHHHHHHHHHCC-	37.70	29472430

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SEP15_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SEP15_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SEP15_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SEP15_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.