UniProt ID | SEP15_MOUSE | |
---|---|---|
UniProt AC | Q9ERR7 | |
Protein Name | Selenoprotein F {ECO:0000250|UniProtKB:O60613} | |
Gene Name | Selenof {ECO:0000312|MGI:MGI:1927947} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 162 | |
Subcellular Localization | Endoplasmic reticulum lumen. The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum.. | |
Protein Description | May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum (By similarity).. | |
Protein Sequence | MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFASEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
119 | Acetylation | LFRGLQIKYVRGSDP CCCCEEEEEEECCCC | 25.40 | 22826441 | |
148 | Phosphorylation | LSILKWNTDSVEEFL HHHHCCCCHHHHHHH | 28.65 | 24719451 | |
150 | Phosphorylation | ILKWNTDSVEEFLSE HHCCCCHHHHHHHHH | 29.41 | 23737553 | |
156 | Phosphorylation | DSVEEFLSEKLERI- HHHHHHHHHHHHCC- | 37.70 | 29472430 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP15_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP15_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP15_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SEP15_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...