| UniProt ID | SEP11_RAT | |
|---|---|---|
| UniProt AC | B3GNI6 | |
| Protein Name | Septin-11 | |
| Gene Name | 11-Sep | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 431 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Cell junction, synapse. Cell projection, dendritic spine. Cell projection, axon. Partly colocalizes with stress fibers. Association with microtubules not observed in embryonic fibroblasts. In cultured hippocampal neurons, loc | |
| Protein Description | Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity.. | |
| Protein Sequence | MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNPWLCTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAVAVGRPS ------CCEECCCCC | 9.66 | - | |
| 9 | Phosphorylation | AVAVGRPSNEELRNL CEECCCCCHHHHHCC | 56.35 | 27097102 | |
| 17 | Phosphorylation | NEELRNLSLSGHVGF HHHHHCCCCCCCCCC | 24.84 | 27097102 | |
| 19 | Phosphorylation | ELRNLSLSGHVGFDS HHHCCCCCCCCCCCC | 24.39 | 27097102 | |
| 175 | Ubiquitination | TMKKLDSKVNIIPII EHHHCCCCCCEEEEE | 38.68 | - | |
| 190 | Acetylation | AKADTIAKNELHKFK ECCCHHHHHHHHHHH | 47.29 | 72615329 | |
| 195 | Acetylation | IAKNELHKFKSKIMS HHHHHHHHHHHHHHH | 68.09 | 72610639 | |
| 310 | Phosphorylation | EEMGFKDTDPDSKPF HHCCCCCCCCCCCCC | 50.45 | 28689409 | |
| 314 | Phosphorylation | FKDTDPDSKPFSLQE CCCCCCCCCCCCHHH | 47.84 | 28689409 | |
| 315 | Acetylation | KDTDPDSKPFSLQET CCCCCCCCCCCHHHH | 58.42 | - | |
| 315 | Ubiquitination | KDTDPDSKPFSLQET CCCCCCCCCCCHHHH | 58.42 | - | |
| 322 | Phosphorylation | KPFSLQETYEAKRNE CCCCHHHHHHHHHHH | 17.44 | 28689409 | |
| 336 | Ubiquitination | EFLGELQKKEEEMRQ HHHHHHHHHHHHHHH | 74.83 | - | |
| 357 | Acetylation | KEKEAELKEAEKELH HHHHHHHHHHHHHHH | 46.51 | - | |
| 361 | Acetylation | AELKEAEKELHEKFD HHHHHHHHHHHHHHH | 73.04 | 72530321 | |
| 366 | Acetylation | AEKELHEKFDLLKRT HHHHHHHHHHHHHHH | 33.17 | 72630119 | |
| 371 | Acetylation | HEKFDLLKRTHQEEK HHHHHHHHHHHHHHH | 63.65 | 72605497 | |
| 386 | Ubiquitination | KKVEDKKKELEEEVS HHHHHHHHHHHHHHH | 73.58 | - | |
| 397 | Acetylation | EEVSNFQKKKAAAQL HHHHHHHHHHHHHHH | 52.70 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP11_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP11_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP11_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SEP11_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
