UniProt ID | SELW_HUMAN | |
---|---|---|
UniProt AC | P63302 | |
Protein Name | Selenoprotein W {ECO:0000303|PubMed:27645994, ECO:0000303|PubMed:9256076} | |
Gene Name | SELENOW {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:10752} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 87 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity).. | |
Protein Sequence | MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Ubiquitination | KYLQLKKKLEDEFPG HHHHHHHHHHHCCCC | 56.36 | 30230243 | |
37 | S-glutathionyl cysteine | FPGRLDICGEGTPQA CCCCCEECCCCCCCC | 3.97 | - | |
37 | Glutathionylation | FPGRLDICGEGTPQA CCCCCEECCCCCCCC | 3.97 | - | |
59 | Phosphorylation | VAGKLIHSKKKGDGY ECCEEEECCCCCCCC | 38.89 | 26074081 | |
66 | Phosphorylation | SKKKGDGYVDTESKF CCCCCCCCCCCHHHH | 10.41 | 23403867 | |
69 | Phosphorylation | KGDGYVDTESKFLKL CCCCCCCCHHHHHHH | 31.92 | 26074081 | |
71 | Phosphorylation | DGYVDTESKFLKLVA CCCCCCHHHHHHHHH | 30.69 | 26074081 | |
75 | Acetylation | DTESKFLKLVAAIKA CCHHHHHHHHHHHHH | 44.01 | 30592315 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SELW_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SELW_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SELW_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SELW_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...