UniProt ID | SELT_HUMAN | |
---|---|---|
UniProt AC | P62341 | |
Protein Name | Thioredoxin reductase-like selenoprotein T {ECO:0000305} | |
Gene Name | SELENOT {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:18136} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 195 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
Protein Description | Selenoprotein with thioredoxin reductase-like oxidoreductase activity (By similarity). Protects dopaminergic neurons against oxidative stress ans cell death. [PubMed: 26866473 Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (By similarity Plays a role in fibroblast anchorage and redox regulation (By similarity In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (By similarity In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP-induced insulin secretion (By similarity] | |
Protein Sequence | MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | LLLLVAASAMVRSEA HHHHHHHHHHHHHHH | 13.73 | - | |
20 | Phosphorylation | AMVRSEASANLGGVP HHHHHHHHHCCCCCC | 17.40 | - | |
29 | Ubiquitination | NLGGVPSKRLKMQYA CCCCCCCHHHHCCCC | 56.53 | 29967540 | |
32 | Ubiquitination | GVPSKRLKMQYATGP CCCCHHHHCCCCCCC | 28.17 | 21890473 | |
58 | Phosphorylation | YRRVFEEYMRVISQR HHHHHHHHHHHHHHH | 5.30 | 24719451 | |
63 | Phosphorylation | EEYMRVISQRYPDIR HHHHHHHHHHCCCCE | 13.02 | 24719451 | |
164 | Phosphorylation | PVWSKLESGHLPSMQ CHHHHCCCCCCCCHH | 41.78 | 23879269 | |
189 | Phosphorylation | KLNVHMDSIPHHRS- CCEECCCCCCCCCC- | 30.37 | 27080861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SELT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SELT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SELT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SELT_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...