dbPTM

SELS_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SELS_MOUSE
UniProt AC	Q9BCZ4
Protein Name	Selenoprotein S {ECO:0000250\|UniProtKB:Q9BQE4}
Gene Name	Selenos {ECO:0000312\|MGI:MGI:95994}
Organism	Mus musculus (Mouse).
Sequence Length	190
Subcellular Localization	Endoplasmic reticulum membrane Single-pass membrane protein. Cytoplasm.
Protein Description	Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination (By similarity)..
Protein Sequence	MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Phosphorylation	YIVIQRLSLRLRALR HHHHHHHHHHHHHHH	17.40	24704852
77	Ubiquitination	LEPDVVVKRQEALAA CCCCCHHHHHHHHHH	36.43	22790023
99	Ubiquitination	DLNAQVEKHKEKLRQ HHHHHHHHHHHHHHH	62.21	22790023
132	Phosphorylation	GRSYKRNSGRPQEED HCCCCCCCCCCCCCC	39.97	27841257

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SELS_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SELS_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SELS_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SELS_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SELS_MOUSE

Related Literatures of Post-Translational Modification