UniProt ID | SELS_MOUSE | |
---|---|---|
UniProt AC | Q9BCZ4 | |
Protein Name | Selenoprotein S {ECO:0000250|UniProtKB:Q9BQE4} | |
Gene Name | Selenos {ECO:0000312|MGI:MGI:95994} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 190 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. Cytoplasm. |
|
Protein Description | Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination (By similarity).. | |
Protein Sequence | MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | YIVIQRLSLRLRALR HHHHHHHHHHHHHHH | 17.40 | 24704852 | |
77 | Ubiquitination | LEPDVVVKRQEALAA CCCCCHHHHHHHHHH | 36.43 | 22790023 | |
99 | Ubiquitination | DLNAQVEKHKEKLRQ HHHHHHHHHHHHHHH | 62.21 | 22790023 | |
132 | Phosphorylation | GRSYKRNSGRPQEED HCCCCCCCCCCCCCC | 39.97 | 27841257 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SELS_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SELS_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SELS_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SELS_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...