dbPTM

SEH1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SEH1_ARATH
UniProt AC	Q93VR9
Protein Name	Protein SEH1 {ECO:0000303\|PubMed:21189294}
Gene Name	SEH1 {ECO:0000303\|PubMed:21189294}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	326
Subcellular Localization	Nucleus envelope . Nucleus . Cytoplasm . Nucleus, nuclear pore complex . Part of the cellular SEH1 pool is not permanently associated with the Nup107-160 complex.
Protein Description	Required for proper export of mRNAs from the nucleus to the cytoplasm..
Protein Sequence	MAKSMATLDSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPSEYGDAVACVCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVAAYSDGYLRVFELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLAFNSDSPHLNSSKIWEFDEAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAVATHKGIGIWHVGLAPDLEGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVKLWQSNLNGEWHEQATLEPVPS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SEH1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SEH1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SEH1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SEH1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SEH1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SEH1_ARATH

Related Literatures of Post-Translational Modification