SEGN_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SEGN_RAT
• UniProt AC: Q6R556
• Protein Name: Secretagogin
• Gene Name: Scgn
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 276
• Subcellular Localization: Cytoplasm . Secreted . Cytoplasmic vesicle, secretory vesicle membrane ; Peripheral membrane protein ; Cytoplasmic side . Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions. A small proportion i
• Protein Sequence: MDNAHRQTQAHLDAACFWQIWQRFDKDEKGYIKETELDAFFDDLLAKFGIEDTLMEENVQKMKEQLMVGHDISKEGRILMKELASMFLSEDENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAAELSNFLRDLFLHHKKVISEAELEEYTSTMEKIFDRNKDGRLDLNDLARILALQENFLLQFKMDASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
193	Phosphorylation	LQFKMDASSTEERKR HHCCCCCCCHHHHHH	33.26	28432305
194	Phosphorylation	QFKMDASSTEERKRD HCCCCCCCHHHHHHH	41.37	28432305
195	Phosphorylation	FKMDASSTEERKRDF CCCCCCCHHHHHHHH	39.09	28432305
236	Phosphorylation	MMELVQPSISGVDLD HHHHHCCCCCCCCHH	16.58	28432305
238	Phosphorylation	ELVQPSISGVDLDKF HHHCCCCCCCCHHHH	36.78	28432305

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SEGN_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SEGN_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SEGN_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of SEGN_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.