UniProt ID | SEC13_MOUSE | |
---|---|---|
UniProt AC | Q9D1M0 | |
Protein Name | Protein SEC13 homolog {ECO:0000305} | |
Gene Name | Sec13 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 322 | |
Subcellular Localization |
Cytoplasmic vesicle, COPII-coated vesicle membrane Peripheral membrane protein Cytoplasmic side . Endoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side . Nucleus, nuclear pore complex . Lysosome membrane . In interphase, |
|
Protein Description | Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.; As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex. It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1.. | |
Protein Sequence | MVSVMNTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASITEGQQNEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MVSVMNTVD ------CCCCCCCCC | 6.25 | - | |
3 | Phosphorylation | -----MVSVMNTVDT -----CCCCCCCCCC | 17.85 | - | |
10 | Phosphorylation | SVMNTVDTSHEDMIH CCCCCCCCCHHHHHC | 27.87 | - | |
11 | Phosphorylation | VMNTVDTSHEDMIHD CCCCCCCCHHHHHCH | 22.03 | - | |
38 | Acetylation | CSSDRSVKIFDVRNG CCCCCCEEEEEECCC | 38.61 | 22826441 | |
87 | Acetylation | DRKVIIWKEENGTWE CCEEEEEECCCCCEE | 44.75 | 23954790 | |
87 | Ubiquitination | DRKVIIWKEENGTWE CCEEEEEECCCCCEE | 44.75 | - | |
87 | Succinylation | DRKVIIWKEENGTWE CCEEEEEECCCCCEE | 44.75 | 23954790 | |
166 | Phosphorylation | APAVVPGSLIDQPSG CCEECCCCCCCCCCC | 18.97 | - | |
175 | Ubiquitination | IDQPSGQKPNYIKKF CCCCCCCCCCHHHHH | 38.46 | 22790023 | |
181 | Acetylation | QKPNYIKKFASGGCD CCCCHHHHHHCCCCH | 36.28 | 22826441 | |
181 | Ubiquitination | QKPNYIKKFASGGCD CCCCHHHHHHCCCCH | 36.28 | 22790023 | |
184 | Phosphorylation | NYIKKFASGGCDNLI CHHHHHHCCCCHHHH | 38.56 | 28066266 | |
192 | Acetylation | GGCDNLIKLWREEED CCCHHHHHHHHHCCC | 45.20 | 22826441 | |
203 | Acetylation | EEEDGQWKEEQKLEA HCCCCCCCHHHHHHH | 43.41 | 23954790 | |
234 | Glutathionylation | PTSTIASCSQDGRVF CCHHEEEECCCCCEE | 2.90 | 24333276 | |
234 | S-palmitoylation | PTSTIASCSQDGRVF CCHHEEEECCCCCEE | 2.90 | 28526873 | |
292 | Phosphorylation | KVTLWKESVDGQWVC EEEEEEECCCCEEEE | 23.06 | 23140645 | |
301 | Phosphorylation | DGQWVCISDVNKGQG CCEEEEEEEECCCCC | 30.31 | 23140645 | |
309 | Phosphorylation | DVNKGQGSVSASITE EECCCCCEEEEEECC | 12.66 | 26824392 | |
311 | Phosphorylation | NKGQGSVSASITEGQ CCCCCEEEEEECCCC | 20.28 | 23684622 | |
313 | Phosphorylation | GQGSVSASITEGQQN CCCEEEEEECCCCCC | 23.65 | 20415495 | |
315 | Phosphorylation | GSVSASITEGQQNEQ CEEEEEECCCCCCCC | 31.41 | 29550500 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEC13_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEC13_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEC13_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SEC13_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...