| UniProt ID | SDHB_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQA3 | |
| Protein Name | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial | |
| Gene Name | Sdhb | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 282 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
| Protein Description | Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).. | |
| Protein Sequence | MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 43 | Acetylation | AAAPRIKKFAIYRWD HHCCHHCEEEEEECC | 24062335 | ||
| 53 | Acetylation | IYRWDPDKTGDKPRM EEECCCCCCCCCCCC | 23576753 | ||
| 57 | Acetylation | DPDKTGDKPRMQTYE CCCCCCCCCCCEEEE | 23576753 | ||
| 62 | Phosphorylation | GDKPRMQTYEVDLNK CCCCCCEEEEECHHH | 28576409 | ||
| 69 | Acetylation | TYEVDLNKCGPMVLD EEEECHHHHHHHHHH | 24062335 | ||
| 69 | Succinylation | TYEVDLNKCGPMVLD EEEECHHHHHHHHHH | 26388266 | ||
| 70 | S-nitrosocysteine | YEVDLNKCGPMVLDA EEECHHHHHHHHHHH | - | ||
| 70 | S-palmitoylation | YEVDLNKCGPMVLDA EEECHHHHHHHHHHH | 28526873 | ||
| 125 | Acetylation | RIDTDLSKVSKIYPL ECCCCHHHHCCEECC | 23201123 | ||
| 128 | Acetylation | TDLSKVSKIYPLPHM CCHHHHCCEECCCCE | 24062335 | ||
| 128 | Succinylation | TDLSKVSKIYPLPHM CCHHHHCCEECCCCE | 23954790 | ||
| 139 | Acetylation | LPHMYVIKDLVPDLS CCCEEEHHHHCCCHH | 23864654 | ||
| 146 | Phosphorylation | KDLVPDLSNFYAQYK HHHCCCHHHHHHHHH | 23984901 | ||
| 149 | Phosphorylation | VPDLSNFYAQYKSIE CCCHHHHHHHHHCCH | 23984901 | ||
| 152 | Phosphorylation | LSNFYAQYKSIEPYL HHHHHHHHHCCHHHH | 23984901 | ||
| 153 | Acetylation | SNFYAQYKSIEPYLK HHHHHHHHCCHHHHC | 23954790 | ||
| 153 | Succinylation | SNFYAQYKSIEPYLK HHHHHHHHCCHHHHC | 23954790 | ||
| 160 | Acetylation | KSIEPYLKKKDESQE HCCHHHHCCCCCCHH | 23864654 | ||
| 160 | Succinylation | KSIEPYLKKKDESQE HCCHHHHCCCCCCHH | 23954790 | ||
| 169 | Acetylation | KDESQEGKQQYLQSI CCCCHHHHHHHHHHH | 23864654 | ||
| 208 | Phosphorylation | YWWNGDKYLGPAVLM CCCCCCCCCHHHHHH | 22817900 | ||
| 218 | Phosphorylation | PAVLMQAYRWMIDSR HHHHHHHHHHHHHCC | 22817900 | ||
| 224 | Phosphorylation | AYRWMIDSRDDFTEE HHHHHHHCCCCCCHH | 22817900 | ||
| 235 | Ubiquitination | FTEERLAKLQDPFSV CCHHHHHHCCCCCCE | - | ||
| 235 | Acetylation | FTEERLAKLQDPFSV CCHHHHHHCCCCCCE | 23576753 | ||
| 251 | S-palmitoylation | RCHTIMNCTQTCPKG EEECCCCCCCCCCCC | 28526873 | ||
| 255 | S-palmitoylation | IMNCTQTCPKGLNPG CCCCCCCCCCCCCCH | 28526873 | ||
| 269 | Acetylation | GKAIAEIKKMMATYK HHHHHHHHHHHHHHH | 23576753 | ||
| 276 | Succinylation | KKMMATYKEKRALA- HHHHHHHHHHHHHC- | 23806337 | ||
| 276 | Acetylation | KKMMATYKEKRALA- HHHHHHHHHHHHHC- | 23806337 | ||
| 278 | Acetylation | MMATYKEKRALA--- HHHHHHHHHHHC--- | 6566475 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDHB_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDHB_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDHB_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SDHB_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...