UniProt ID | SDHB3_ARATH | |
---|---|---|
UniProt AC | Q9FJP9 | |
Protein Name | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial | |
Gene Name | SDH2-3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 309 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
Protein Description | Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).. | |
Protein Sequence | MSSVLRLLGRRICNPAAEKVRLSSSLSGGGDFPILNGHKAAQDLSKDTLKSQDITKEKEGQHKEVKKEFKIYRWNPDKPNSKPFLQSFFVDLSSCGPMVLDVLQKIKAEDDASLSYRRSCREGICGSCSMNIDGTNTVACLKPINPNTSKPTIITPLPHMYVIKDLVVDLTNFYQQYKSMEPWLKTRKPPKDGREHRQSPKDRKKLDGLYECILCACCTTSCPSYWWNPEEFPGPAALLQAYRWISDSRDEYREERLQAITESETKVYRCRAIKNCTATCPKGLNPASAILKMKSKHLLSDPLVRTESV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SDHB3_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDHB3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDHB3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDHB3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SDHB3_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...