SDF2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SDF2_ARATH
• UniProt AC: Q93ZE8
• Protein Name: Stromal cell-derived factor 2-like protein
• Gene Name: SDF2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 218
• Subcellular Localization: Endoplasmic reticulum .
• Protein Description: Involved in the endoplasmic reticulum (ER) protein quality control and unfolded protein response. May be involved in the quality control of glycoproteins. Forms a complex in the ER with ERDJ3B and MED37A/BIP1 which is required for the proper accumulation and function of the surface-exposed leucine-rich repeat receptor kinases EFR involved in pathogen-associated molecular pattern (PAMP) triggered immunity..
• Protein Sequence: MALGFFCLAIFLYLSLDPDSGYTSASAAASGKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPGTTEKQGDAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLIIEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKADNIWLAAEGVYLPLNESSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
214	N-linked_Glycosylation	EGVYLPLNESSK--- ECEEEECCCCCC---	45.20	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SDF2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SDF2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SDF2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SDF2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.