SDF2L_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SDF2L_MOUSE
• UniProt AC: Q9ESP1
• Protein Name: Stromal cell-derived factor 2-like protein 1
• Gene Name: Sdf2l1
• Organism: Mus musculus (Mouse).
• Sequence Length: 221
• Subcellular Localization: Endoplasmic reticulum lumen .
• Protein Sequence: MWGASRGRVAGPTLLGLLLALSVRSGGASKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Glutathionylation	ASAGLVTCGSVLKLL HHCCEEEHHHHHHHH	2.74	24333276
75	Phosphorylation	SVTGVEESDDANSYW CEECEECCCCCCCCE	27.56	26525534
92	Glutathionylation	RGGSEGGCPRGLPVR CCCCCCCCCCCCCCC	2.82	24333276
215	Phosphorylation	IKPGADLSTGHDEL- ECCCCCCCCCCCCC-	32.65	27841257

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SDF2L_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SDF2L_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SDF2L_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SDF2L_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.