UniProt ID | SDF2L_MOUSE | |
---|---|---|
UniProt AC | Q9ESP1 | |
Protein Name | Stromal cell-derived factor 2-like protein 1 | |
Gene Name | Sdf2l1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 221 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | ||
Protein Sequence | MWGASRGRVAGPTLLGLLLALSVRSGGASKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Glutathionylation | ASAGLVTCGSVLKLL HHCCEEEHHHHHHHH | 2.74 | 24333276 | |
75 | Phosphorylation | SVTGVEESDDANSYW CEECEECCCCCCCCE | 27.56 | 26525534 | |
92 | Glutathionylation | RGGSEGGCPRGLPVR CCCCCCCCCCCCCCC | 2.82 | 24333276 | |
215 | Phosphorylation | IKPGADLSTGHDEL- ECCCCCCCCCCCCC- | 32.65 | 27841257 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDF2L_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDF2L_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDF2L_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SDF2L_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...