dbPTM

SDF2A_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SDF2A_DROME
UniProt AC	Q4V5I9
Protein Name	Succinate dehydrogenase assembly factor 2-A, mitochondrial {ECO:0000255\|HAMAP-Rule:MF_03057}
Gene Name	CG14757
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	163
Subcellular Localization	Mitochondrion matrix .
Protein Description	Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit of the SDH catalytic dimer..
Protein Sequence	MLRQLRLTMDISGWIFLPWRRSMSNMKDSPPPPPPLASTFNDVIVDYEDPDYLPLPEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIYYWATEVKPTPKEYDTEIMGLLKEHVKNAERVTRLRQPDLNI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SDF2A_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SDF2A_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SDF2A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SDF2A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SDF2A_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SDF2A_DROME

Related Literatures of Post-Translational Modification