dbPTM

SDC4_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SDC4_RAT
UniProt AC	P34901
Protein Name	Syndecan-4
Gene Name	Sdc4
Organism	Rattus norvegicus (Rat).
Sequence Length	202
Subcellular Localization	Membrane Single-pass type I membrane protein . Secreted . Shedding of the ectodomain produces a soluble form.
Protein Description	Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP..
Protein Sequence	MAPVCLFAPLLLLLLGGFPVAPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGLEQDSDFELSGSGDLDDTEEPRTFPEVISPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRVPSDVGDDDVSNKVSMSSTSQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	O-linked_Glycosylation	LLEGRYFSGALPDDE HHCCCCCCCCCCCCC	17.77	-
65	O-linked_Glycosylation	QDSDFELSGSGDLDD CCCCCCCCCCCCCCC	24.58	-
67	O-linked_Glycosylation	SDFELSGSGDLDDTE CCCCCCCCCCCCCCC	26.26	-
183	Phosphorylation	MKKKDEGSYDLGKKP HHHCCCCCCCCCCCC	17.27	16310216
184	Phosphorylation	KKKDEGSYDLGKKPI HHCCCCCCCCCCCCC	26.50	30181290
194	Ubiquitination	GKKPIYKKAPTNEFY CCCCCCCCCCCCCCC	42.50	-
201	Phosphorylation	KAPTNEFYA------ CCCCCCCCC------	12.77	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
183	S	Phosphorylation	Kinase	PRKCA	P17252	GPS
183	S	Phosphorylation	Kinase	PRKCD	Q05655	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SDC4_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SDC4_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SDC4_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SDC4_RAT

Related Literatures of Post-Translational Modification