dbPTM

SCP42_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SCP42_ARATH
UniProt AC	Q9FH05
Protein Name	Serine carboxypeptidase-like 42
Gene Name	SCPL42
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	473
Subcellular Localization	Secreted .
Protein Description	Probable carboxypeptidase..
Protein Sequence	MASVSWRAVAVAMVVVLLSLQWFAKGYPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTGDKSTANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSSGFKFNIKGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFDDYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
138	N-linked_Glycosylation	GVGWSYSNKSSDYNT CCCCCCCCCCCCCCC	39.74	-
259	N-linked_Glycosylation	YTFASPHNVSTACNE CCCCCCCCHHHHHHH	32.58	-
335	N-linked_Glycosylation	VQKALHANRTHLPYS HHHHHHCCCCCCCCC	38.34	-
351	N-linked_Glycosylation	SMCSGVLNYSDIDGN HHHCCCCCHHHCCCC	31.68	-
465	N-linked_Glycosylation	VSGRRLPNNTHSSTD HCCCCCCCCCCCCCC	71.30	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SCP42_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SCP42_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SCP42_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SCP42_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SCP42_ARATH

Related Literatures of Post-Translational Modification