UniProt ID | SCP42_ARATH | |
---|---|---|
UniProt AC | Q9FH05 | |
Protein Name | Serine carboxypeptidase-like 42 | |
Gene Name | SCPL42 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 473 | |
Subcellular Localization | Secreted . | |
Protein Description | Probable carboxypeptidase.. | |
Protein Sequence | MASVSWRAVAVAMVVVLLSLQWFAKGYPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTGDKSTANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSSGFKFNIKGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFDDYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | N-linked_Glycosylation | GVGWSYSNKSSDYNT CCCCCCCCCCCCCCC | 39.74 | - | |
259 | N-linked_Glycosylation | YTFASPHNVSTACNE CCCCCCCCHHHHHHH | 32.58 | - | |
335 | N-linked_Glycosylation | VQKALHANRTHLPYS HHHHHHCCCCCCCCC | 38.34 | - | |
351 | N-linked_Glycosylation | SMCSGVLNYSDIDGN HHHCCCCCHHHCCCC | 31.68 | - | |
465 | N-linked_Glycosylation | VSGRRLPNNTHSSTD HCCCCCCCCCCCCCC | 71.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCP42_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCP42_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCP42_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SCP42_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...