UniProt ID | SCN2B_RAT | |
---|---|---|
UniProt AC | P54900 | |
Protein Name | Sodium channel subunit beta-2 | |
Gene Name | Scn2b | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 215 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier.. | |
Protein Sequence | MHRDAWLPRPAFSLTGLSLFFSLVPSGRSMEVTVPTTLSVLNGSDTRLPCTFNSCYTVNHKQFSLNWTYQECSNCSEEMFLQFRMKIINLKLERFGDRVEFSGNPSKYDVSVTLKNVQLEDEGIYNCYITNPPDRHRGHGKIYLQVLLEVPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNAEDGAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | N-linked_Glycosylation | PTTLSVLNGSDTRLP CCEEEECCCCCCCCC | 45.85 | - | |
66 | N-linked_Glycosylation | NHKQFSLNWTYQECS CCCEEEEEEEEHHCC | 28.04 | - | |
74 | N-linked_Glycosylation | WTYQECSNCSEEMFL EEEHHCCCCCHHHHH | 45.02 | - | |
108 | Phosphorylation | FSGNPSKYDVSVTLK ECCCCCCCEEEEEEE | 26.39 | - | |
111 | Phosphorylation | NPSKYDVSVTLKNVQ CCCCCEEEEEEECEE | 13.39 | - | |
192 | Phosphorylation | RKKEQKLSTDDLKTE HHHHHCCCHHHCCCH | 36.50 | 25403869 | |
197 | Ubiquitination | KLSTDDLKTEEEGKT CCCHHHCCCHHCCCC | 61.97 | - | |
198 | Phosphorylation | LSTDDLKTEEEGKTD CCHHHCCCHHCCCCC | 56.79 | 25403869 | |
203 | Ubiquitination | LKTEEEGKTDGEGNA CCCHHCCCCCCCCCC | 46.88 | - | |
204 | Phosphorylation | KTEEEGKTDGEGNAE CCHHCCCCCCCCCCC | 61.16 | 30411139 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCN2B_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCN2B_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCN2B_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SCN2B_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...