UniProt ID | SCIMP_HUMAN | |
---|---|---|
UniProt AC | Q6UWF3 | |
Protein Name | SLP adapter and CSK-interacting membrane protein | |
Gene Name | SCIMP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 145 | |
Subcellular Localization |
Membrane Single-pass membrane protein . Membrane Lipid-anchor . Together with MHC-II, associates with lipid-enriched microdomains called tetraspanin-enriched microdomains (TEMs). Rapidly translocates into immunological synapse (IS) at cell-cell c |
|
Protein Description | Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation.. | |
Protein Sequence | MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTEKASF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MDTFTVQDST -----CCCEECCCCH | 21.65 | 22210691 | |
5 | Phosphorylation | ---MDTFTVQDSTAM ---CCCEECCCCHHH | 21.25 | 22210691 | |
10 | Phosphorylation | TFTVQDSTAMSWWRN CEECCCCHHHHHHHH | 34.37 | 22210691 | |
13 | Phosphorylation | VQDSTAMSWWRNNFW CCCCHHHHHHHHHHH | 22.48 | 22210691 | |
40 | S-palmitoylation | GLGLILYCVCKWQLR HHHHHHHHHHHHHHH | 2.31 | 21930792 | |
42 | S-palmitoylation | GLILYCVCKWQLRRG HHHHHHHHHHHHHCC | 3.11 | 21930792 | |
69 | Phosphorylation | QVDEEKMYENVLNES CCCHHHHHHHHHCCC | 18.54 | 21930792 | |
76 | Phosphorylation | YENVLNESPVQLPPL HHHHHCCCCCCCCCC | 29.33 | 30108239 | |
90 | Phosphorylation | LPPRNWPSLEDSSPQ CCCCCCCCCCCCCCC | 35.69 | 24719451 | |
94 | Phosphorylation | NWPSLEDSSPQEAPS CCCCCCCCCCCCCCC | 34.25 | 28450419 | |
95 | Phosphorylation | WPSLEDSSPQEAPSQ CCCCCCCCCCCCCCC | 42.81 | 28450419 | |
101 | Phosphorylation | SSPQEAPSQPPATYS CCCCCCCCCCCCCHH | 63.47 | 28348404 | |
106 | Phosphorylation | APSQPPATYSLVNKV CCCCCCCCHHHHHHC | 21.29 | 28348404 | |
107 | Phosphorylation | PSQPPATYSLVNKVK CCCCCCCHHHHHHCC | 11.34 | 21930792 | |
108 | Phosphorylation | SQPPATYSLVNKVKN CCCCCCHHHHHHCCC | 22.83 | 28348404 | |
123 | Phosphorylation | KKTVSIPSYIEPEDD CCCCCCCCCCCCCCC | 36.75 | 28348404 | |
124 | Phosphorylation | KTVSIPSYIEPEDDY CCCCCCCCCCCCCCC | 12.16 | - | |
131 | Phosphorylation | YIEPEDDYDDVEIPA CCCCCCCCCCCCCCC | 26.77 | 21930792 | |
140 | Phosphorylation | DVEIPANTEKASF-- CCCCCCCCCCCCC-- | 40.75 | 30108239 | |
144 | Phosphorylation | PANTEKASF------ CCCCCCCCC------ | 42.42 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCIMP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCIMP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCIMP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SCIMP_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...