UniProt ID | SCAM5_RAT | |
---|---|---|
UniProt AC | Q9JKE3 | |
Protein Name | Secretory carrier-associated membrane protein 5 | |
Gene Name | Scamp5 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 235 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein. Recycling endosome membrane Multi-pass membrane protein. Cytoplasmic vesicle, s |
|
Protein Description | Required for the calcium-dependent exocytosis of signal sequence-containing cytokines such as CCL5. Probably acts in cooperation with the SNARE machinery (By similarity).. | |
Protein Sequence | MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSTTPNYTYSNEM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Ubiquitination | ----MAEKVNNFPPL ----CCCCCCCCCCC | 40.50 | - | |
182 | Phosphorylation | FYRGSGGSFSKAQEE HHCCCCCCCCHHHHH | 29.85 | 25403869 | |
184 | Phosphorylation | RGSGGSFSKAQEEWT CCCCCCCCHHHHHHC | 28.87 | 25403869 | |
185 | Ubiquitination | GSGGSFSKAQEEWTT CCCCCCCHHHHHHCC | 52.67 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCAM5_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCAM5_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCAM5_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SCAM5_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...