UniProt ID | SCAM1_RAT | |
---|---|---|
UniProt AC | P56603 | |
Protein Name | Secretory carrier-associated membrane protein 1 | |
Gene Name | Scamp1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 338 | |
Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein. Recycling endosome membrane Multi-pass membrane protein. |
|
Protein Description | Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.. | |
Protein Sequence | MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDFDSNPF ------CCCCCCCCC | 47.16 | - | |
2 | Phosphorylation | ------MSDFDSNPF ------CCCCCCCCC | 47.16 | 27097102 | |
6 | Phosphorylation | --MSDFDSNPFADPD --CCCCCCCCCCCCC | 46.53 | 27097102 | |
37 | Phosphorylation | VPPGLDEYNPFSDSR CCCCCCCCCCCCCCC | 28.00 | 22276854 | |
41 | Phosphorylation | LDEYNPFSDSRTPPP CCCCCCCCCCCCCCC | 35.61 | 25403869 | |
43 | Phosphorylation | EYNPFSDSRTPPPGG CCCCCCCCCCCCCCC | 36.53 | 30240740 | |
45 | Phosphorylation | NPFSDSRTPPPGGVK CCCCCCCCCCCCCCC | 44.06 | 30240740 | |
67 | Phosphorylation | QPAIMKPTEEHPAYT CCCCCCCCCCCCCHH | 48.78 | 27097102 | |
73 | Phosphorylation | PTEEHPAYTQITKEH CCCCCCCHHHHCHHH | 12.02 | 27097102 | |
74 | Phosphorylation | TEEHPAYTQITKEHA CCCCCCHHHHCHHHH | 18.66 | 27097102 | |
77 | Phosphorylation | HPAYTQITKEHALAQ CCCHHHHCHHHHHHH | 22.14 | 27097102 | |
89 | Ubiquitination | LAQAELLKRQEELER HHHHHHHHHHHHHHH | 65.74 | - | |
112 | Phosphorylation | EREMQNLSQHGRKNN HHHHHHHHHHCHHCC | 27.90 | 25403869 | |
298 | Ubiquitination | TTGASFEKAQQEFAT CCCCCHHHHHHHHHH | 49.86 | - | |
334 | Ubiquitination | SAAQNAFKGNQM--- HHHHHHHCCCCC--- | 55.32 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCAM1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCAM1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCAM1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SCAM1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...