| UniProt ID | SC6A1_MOUSE | |
|---|---|---|
| UniProt AC | P31648 | |
| Protein Name | Sodium- and chloride-dependent GABA transporter 1 | |
| Gene Name | Slc6a1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 599 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. Membrane Multi-pass membrane protein. Localized at the plasma membrane and in a subset of intracellular vesicles (By similarity). Localized at the presynaptic terminals of interneurons. |
|
| Protein Description | Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.. | |
| Protein Sequence | MATDNSKVADGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRRELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRFYDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPLTMGSYVFPKWGQGVGWLMALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQAGSSASKEAYI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | KVADGQISTEVSEAP CCCCCCCCCEECCCC | 15.61 | 25521595 | |
| 15 | Phosphorylation | VADGQISTEVSEAPV CCCCCCCCEECCCCC | 41.87 | 25521595 | |
| 18 | Phosphorylation | GQISTEVSEAPVASD CCCCCEECCCCCCCC | 23.08 | 25521595 | |
| 24 | Phosphorylation | VSEAPVASDKPKTLV ECCCCCCCCCCCEEE | 46.53 | 29899451 | |
| 26 | Ubiquitination | EAPVASDKPKTLVVK CCCCCCCCCCEEEEE | 46.01 | 22790023 | |
| 28 | Ubiquitination | PVASDKPKTLVVKVQ CCCCCCCCEEEEEEE | 61.30 | - | |
| 29 | Phosphorylation | VASDKPKTLVVKVQK CCCCCCCEEEEEEEH | 33.06 | 29899451 | |
| 33 | Ubiquitination | KPKTLVVKVQKKAGD CCCEEEEEEEHHCCC | 31.31 | 22790023 | |
| 37 | Ubiquitination | LVVKVQKKAGDLPDR EEEEEEHHCCCCCCC | 40.28 | 22790023 | |
| 164 | S-palmitoylation | TTLPWKQCDNPWNTD CCCCHHHCCCCCCCC | 4.91 | 28680068 | |
| 176 | N-linked_Glycosylation | NTDRCFSNYSLVNTT CCCCCCCCCEEEECC | 15.34 | - | |
| 181 | N-linked_Glycosylation | FSNYSLVNTTNMTSA CCCCEEEECCCCHHH | 46.62 | - | |
| 184 | N-linked_Glycosylation | YSLVNTTNMTSAVVE CEEEECCCCHHHHHH | 29.69 | - | |
| 493 | S-palmitoylation | EMVGSRPCIWWKLCW HHHCCCCCHHHHHHH | 3.85 | 28680068 | |
| 591 | Phosphorylation | PEQPQAGSSASKEAY CCCCCCCCCCCCCCC | 26.25 | 25521595 | |
| 592 | Phosphorylation | EQPQAGSSASKEAYI CCCCCCCCCCCCCCC | 35.33 | 19060867 | |
| 594 | Phosphorylation | PQAGSSASKEAYI-- CCCCCCCCCCCCC-- | 32.74 | 25521595 | |
| 595 | Ubiquitination | QAGSSASKEAYI--- CCCCCCCCCCCC--- | 46.19 | 22790023 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC6A1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC6A1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC6A1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SC6A1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
