SC61B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SC61B_SCHPO
• UniProt AC: O43002
• Protein Name: Protein transport protein sec61 subunit beta
• Gene Name: sbh1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 102
• Subcellular Localization: Endoplasmic reticulum membrane ; Single-pass membrane protein .
• Protein Description: Necessary for protein translocation in the endoplasmic reticulum..
• Protein Sequence: MSSTKASGSVKNSAASAPGGPKSQIRRRAAVEKNTKESNSGPAGARAAGAPGSTPTLLKLYTDEASGFKVDPVVVMVLSVGFIASVFLLHIVARILKKFASE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MSSTKASGSVKNSA -CCCCCCCCCCCCCC	32.91	25720772
9	Phosphorylation	SSTKASGSVKNSAAS CCCCCCCCCCCCCCC	27.67	25720772
13	Phosphorylation	ASGSVKNSAASAPGG CCCCCCCCCCCCCCC	21.35	25720772
16	Phosphorylation	SVKNSAASAPGGPKS CCCCCCCCCCCCCHH	34.41	27738172
23	Phosphorylation	SAPGGPKSQIRRRAA CCCCCCHHHHHHHHH	33.69	25720772
53	Phosphorylation	RAAGAPGSTPTLLKL HHCCCCCCCCHHHHH	30.10	25720772
54	Phosphorylation	AAGAPGSTPTLLKLY HCCCCCCCCHHHHHH	26.63	25720772
56	Phosphorylation	GAPGSTPTLLKLYTD CCCCCCCHHHHHHHC	44.82	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SC61B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SC61B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SC61B_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of SC61B_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.