dbPTM

SC61A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SC61A_SCHPO
UniProt AC	P79088
Protein Name	Protein transport protein sec61 subunit alpha
Gene Name	sec61
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	479
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins and is essential for cell growth. It interacts with other membrane proteins required for protein translocation. Upon binding to sec62/63 complex, secretory precursor polypeptides may engage sec61 to begin membrane penetration event. A cycle of assembly and disassembly of sec62/63 from sec61 may govern the activity of the translocase (By similarity)..
Protein Sequence	MSDLRFLDLVKPFAPFLPEIAAPERKVPFKQKMLWTGVTLLIFLVMSQVPLYGIVSSDSSDPLLWLRMILAANRGTLMELGISPIVTSSMLVQLLVGSQLIEVNMELKSDREMYQLVQKFLAIIIAFGQATAYVLTGMYGRPQDLGAGICLLLILQLAAASLIVLLLDELLQKGYGLGSGISLFIATINCENIFWKAFSPTTYHIANGVQFEGAVINFVYVMFTWDNKAAALYQAFFRSGLTSSQIQLPNLWNFFATLLVFGVVIYLQDFRVEIPIRSQKFRGYRSTFPVKLLYTSNTPIMLQSALTSNLFFASRLLFNRFSSNFLVRFLGVWEQTATSGLSYYLSPPASFQDALIDPIHTLVYVFFTMFACALFSKLWIEVSGASPRDVAKQLKSQQLVMAGHREGSMYKELKRIIPTAAWLSGAVVGALAVASDLLGALGSGTAVLLCTTTIYGYYEQLQKEIKGDQYGLPVTPMMQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	Phosphorylation	EVNMELKSDREMYQL HHHCCCCCHHHHHHH	55.30	21712547
286	Phosphorylation	QKFRGYRSTFPVKLL CCCCCCCCCCCEEEE	26.39	25720772
396	Phosphorylation	DVAKQLKSQQLVMAG HHHHHHHHCCHHHCC	31.58	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SC61A_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SC61A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SC61A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SC61A_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SC61A_SCHPO

Related Literatures of Post-Translational Modification