UniProt ID | SC61A_SCHPO | |
---|---|---|
UniProt AC | P79088 | |
Protein Name | Protein transport protein sec61 subunit alpha | |
Gene Name | sec61 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 479 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins and is essential for cell growth. It interacts with other membrane proteins required for protein translocation. Upon binding to sec62/63 complex, secretory precursor polypeptides may engage sec61 to begin membrane penetration event. A cycle of assembly and disassembly of sec62/63 from sec61 may govern the activity of the translocase (By similarity).. | |
Protein Sequence | MSDLRFLDLVKPFAPFLPEIAAPERKVPFKQKMLWTGVTLLIFLVMSQVPLYGIVSSDSSDPLLWLRMILAANRGTLMELGISPIVTSSMLVQLLVGSQLIEVNMELKSDREMYQLVQKFLAIIIAFGQATAYVLTGMYGRPQDLGAGICLLLILQLAAASLIVLLLDELLQKGYGLGSGISLFIATINCENIFWKAFSPTTYHIANGVQFEGAVINFVYVMFTWDNKAAALYQAFFRSGLTSSQIQLPNLWNFFATLLVFGVVIYLQDFRVEIPIRSQKFRGYRSTFPVKLLYTSNTPIMLQSALTSNLFFASRLLFNRFSSNFLVRFLGVWEQTATSGLSYYLSPPASFQDALIDPIHTLVYVFFTMFACALFSKLWIEVSGASPRDVAKQLKSQQLVMAGHREGSMYKELKRIIPTAAWLSGAVVGALAVASDLLGALGSGTAVLLCTTTIYGYYEQLQKEIKGDQYGLPVTPMMQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
109 | Phosphorylation | EVNMELKSDREMYQL HHHCCCCCHHHHHHH | 55.30 | 21712547 | |
286 | Phosphorylation | QKFRGYRSTFPVKLL CCCCCCCCCCCEEEE | 26.39 | 25720772 | |
396 | Phosphorylation | DVAKQLKSQQLVMAG HHHHHHHHCCHHHCC | 31.58 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC61A_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC61A_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC61A_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SC61A_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...