UniProt ID | SC5D_HUMAN | |
---|---|---|
UniProt AC | O75845 | |
Protein Name | Lathosterol oxidase | |
Gene Name | SC5D | |
Organism | Homo sapiens (Human). | |
Sequence Length | 299 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.. | |
Protein Sequence | MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDHALMKHPQFLKNQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSHSGNGCKNEKLFNGEFTKTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Ubiquitination | MKHPQFLKNQVRREI HHCHHHHHHHHHHHH | 46.77 | 21890473 | |
253 | Phosphorylation | LWDRIGGSFKNPSSF EHHHCCCCCCCCHHC | 28.03 | 28450419 | |
255 | Ubiquitination | DRIGGSFKNPSSFEG HHCCCCCCCCHHCCC | 70.42 | 21890473 | |
255 | Ubiquitination | DRIGGSFKNPSSFEG HHCCCCCCCCHHCCC | 70.42 | 21890473 | |
263 | Ubiquitination | NPSSFEGKGPLSYVK CCHHCCCCCCHHHHH | 50.59 | 21890473 | |
263 | Ubiquitination | NPSSFEGKGPLSYVK CCHHCCCCCCHHHHH | 50.59 | 21890473 | |
270 | Ubiquitination | KGPLSYVKEMTEGKR CCCHHHHHHHHCCCC | 33.27 | - | |
286 | Acetylation | SHSGNGCKNEKLFNG CCCCCCCCCCEECCC | 70.33 | 7711205 | |
289 | Ubiquitination | GNGCKNEKLFNGEFT CCCCCCCEECCCCCE | 68.70 | - | |
297 | Ubiquitination | LFNGEFTKTE----- ECCCCCEECC----- | 56.85 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC5D_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC5D_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC5D_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SC5D_HUMAN !! |
loading...