dbPTM

SC22B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SC22B_MOUSE
UniProt AC	O08547
Protein Name	Vesicle-trafficking protein SEC22b
Gene Name	Sec22b
Organism	Mus musculus (Mouse).
Sequence Length	215
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type IV membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane . Golgi apparatus, cis-Golgi network membrane . Golgi apparatus, trans-Golgi network membrane . Melanosome . Concent
Protein Description	SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER..
Protein Sequence	MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	SMQEDEQSGRDLQQY HHCHHHHCCHHHHHH	33.47	29514104
35	Phosphorylation	RDLQQYQSQAKQLFR HHHHHHHHHHHHHHH	27.46	27841257
38	Ubiquitination	QQYQSQAKQLFRKLN HHHHHHHHHHHHHHH	39.64	-
38	Malonylation	QQYQSQAKQLFRKLN HHHHHHHHHHHHHHH	39.64	26320211
38	Acetylation	QQYQSQAKQLFRKLN HHHHHHHHHHHHHHH	39.64	23864654
50	Phosphorylation	KLNEQSPTRCTLEAG HHHHCCCCCCEEECC	43.56	22817900
82	Ubiquitination	CEAAFPKKLAFAYLE HHHHCCHHHHHHHHH	45.33	22790023
101	Ubiquitination	EFDEQHGKKVPTVSR HHHHHCCCCCCCCCC	48.77	22790023
102	Ubiquitination	FDEQHGKKVPTVSRP HHHHCCCCCCCCCCC	59.02	-
102	Malonylation	FDEQHGKKVPTVSRP HHHHCCCCCCCCCCC	59.02	26320211
137	Phosphorylation	RARRNLGSINTELQD HHHHHHCCCCHHHHH	18.81	24925903
140	Phosphorylation	RNLGSINTELQDVQR HHHCCCCHHHHHHHH	36.08	24925903
164	Phosphorylation	LQRGEALSALDSKAN HHHCHHHHHHHHHHH	33.56	28066266
168	Phosphorylation	EALSALDSKANNLSS HHHHHHHHHHHCHHH	34.22	25521595
169	Ubiquitination	ALSALDSKANNLSSL HHHHHHHHHHCHHHH	55.59	22790023
174	Phosphorylation	DSKANNLSSLSKKYR HHHHHCHHHHCHHHH	31.21	26824392
175	Phosphorylation	SKANNLSSLSKKYRQ HHHHCHHHHCHHHHH	39.57	26824392
177	Phosphorylation	ANNLSSLSKKYRQDA HHCHHHHCHHHHHHH	29.11	27566939
178	Ubiquitination	NNLSSLSKKYRQDAK HCHHHHCHHHHHHHH	60.15	27667366
178	Malonylation	NNLSSLSKKYRQDAK HCHHHHCHHHHHHHH	60.15	26320211
185	Ubiquitination	KKYRQDAKYLNMRST HHHHHHHHHHCCHHH	59.57	27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SC22B_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SC22B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SC22B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SC22B_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SC22B_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"The phagosomal proteome in interferon-gamma-activated macrophages."; Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.; Immunity 30:143-154(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-137, AND MASSSPECTROMETRY.	19144319 [Abstract]
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-137, AND MASSSPECTROMETRY.	19367708 [Abstract]
"Specific phosphopeptide enrichment with immobilized titanium ionaffinity chromatography adsorbent for phosphoproteome analysis."; Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H.; J. Proteome Res. 7:3957-3967(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-137, AND MASSSPECTROMETRY.	18630941 [Abstract]
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168, AND MASSSPECTROMETRY.	17242355 [Abstract]
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-137, AND MASSSPECTROMETRY.	17114649 [Abstract]