SC11A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SC11A_MOUSE
• UniProt AC: Q9R0P6
• Protein Name: Signal peptidase complex catalytic subunit SEC11A
• Gene Name: Sec11a
• Organism: Mus musculus (Mouse).
• Sequence Length: 179
• Subcellular Localization: Microsome membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.
• Protein Description: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum..
• Protein Sequence: MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	WKGLMVITGSESPIV HCCEEEECCCCCCEE	24.20	22871156
54	Phosphorylation	SPIVVVLSGSMEPAF CCEEEEEECCCCCCC	19.74	22871156
56	Phosphorylation	IVVVLSGSMEPAFHR EEEEEECCCCCCCCC	19.32	22871156
114	Ubiquitination	GHIKFLTKGDNNAVD CCEEEEECCCCCCCC	67.43	27667366
127	Ubiquitination	VDDRGLYKQGQHWLE CCCCCHHHCCCHHHH	53.66	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SC11A_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SC11A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SC11A_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SC11A_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.