UniProt ID | SBP3_ARATH | |
---|---|---|
UniProt AC | Q9SK39 | |
Protein Name | Probable steroid-binding protein 3 | |
Gene Name | MP3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 100 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MEFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEFTAEQL -------CCCCHHHH | 9.61 | 22223895 | |
4 | Phosphorylation | ----MEFTAEQLSQY ----CCCCHHHHHHC | 18.91 | 29654922 | |
35 | Ubiquitination | VFDVTTGKSFYGSGG EEEECCCCEECCCCC | 34.99 | - | |
36 | Phosphorylation | FDVTTGKSFYGSGGD EEECCCCEECCCCCC | 25.66 | 30589143 | |
46 | Sulfoxidation | GSGGDYSMFAGKDAS CCCCCCHHCCCHHHH | 1.86 | 25693801 | |
50 | Ubiquitination | DYSMFAGKDASRALG CCHHCCCHHHHHHHH | 46.84 | - | |
58 | Ubiquitination | DASRALGKMSKNEED HHHHHHHHCCCCHHH | 40.63 | - | |
61 | Ubiquitination | RALGKMSKNEEDVSP HHHHHCCCCHHHCCH | 65.95 | - | |
67 | Phosphorylation | SKNEEDVSPSLEGLT CCCHHHCCHHHCCCC | 22.54 | 30291188 | |
69 | Phosphorylation | NEEDVSPSLEGLTEK CHHHCCHHHCCCCHH | 31.39 | 23776212 | |
91 | Ubiquitination | WETKFEAKYPVVGRV HCHHHEEECCCEEEE | 42.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SBP3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SBP3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SBP3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBQ10_ARATH | UBQ10 | physical | 22513011 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...