UniProt ID | SBK1_HUMAN | |
---|---|---|
UniProt AC | Q52WX2 | |
Protein Name | Serine/threonine-protein kinase SBK1 | |
Gene Name | SBK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 424 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | May be involved in signal-transduction pathways related to the control of brain development.. | |
Protein Sequence | MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGPLKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAIEICV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | TLRTLAASDVTKHYE HHHHHHHHHHHHHHH | 27.32 | - | |
50 | Phosphorylation | TLAASDVTKHYELVR HHHHHHHHHHHHHHH | 19.66 | - | |
51 | Ubiquitination | LAASDVTKHYELVRE HHHHHHHHHHHHHHH | 44.00 | - | |
53 | Phosphorylation | ASDVTKHYELVRELG HHHHHHHHHHHHHHC | 16.71 | - | |
61 | Ubiquitination | ELVRELGKGTYGKVD HHHHHHCCCCCCEEE | 61.78 | 29967540 | |
63 | Phosphorylation | VRELGKGTYGKVDLV HHHHCCCCCCEEEEE | 32.36 | 26074081 | |
64 | Phosphorylation | RELGKGTYGKVDLVV HHHCCCCCCEEEEEE | 24.50 | 26074081 | |
66 | Ubiquitination | LGKGTYGKVDLVVYK HCCCCCCEEEEEEEE | 23.35 | - | |
72 | Phosphorylation | GKVDLVVYKGTGTKM CEEEEEEEECCCHHH | 9.02 | 26074081 | |
73 | Ubiquitination | KVDLVVYKGTGTKMA EEEEEEEECCCHHHH | 38.08 | - | |
75 | Phosphorylation | DLVVYKGTGTKMALK EEEEEECCCHHHHHH | 37.21 | 26074081 | |
77 | Phosphorylation | VVYKGTGTKMALKFV EEEECCCHHHHHHHH | 19.93 | 26074081 | |
176 | Ubiquitination | QLVHRDIKPENVLLF EEECCCCCHHHEEEE | 51.04 | 29967540 | |
191 | Ubiquitination | DRECRRVKLADFGMT ECCCCCEEHHHHCCC | 35.83 | - | |
352 | Ubiquitination | LEAPGPLKRTVLTES EECCCCCEEEEEECC | 49.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SBK1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SBK1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SBK1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SBK1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-63 AND TYR-64, AND MASSSPECTROMETRY. |